Skip to main content

Table 1 MALDI-TOF-TOF of various SNPs associated proteins with matched sequences

From: Cellular oxido-reductive proteins of Chlamydomonas reinhardtii control the biosynthesis of silver nanoparticles

No. Protein Name MW Coverage (%) Peptide Full proteins Sequence (Matched peptides bold underlined)
1 Histone H4 11.4 19.4 R.ISGLIYEETR.T; K.TFLENVIR.D; R.DNIQGITKPAIR.R; K.RISGLIYEETR.T MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRR LARRGGVKRISGLIYEETRT VLKTFLENVIR DSVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
2 Carbonic anhydrase 41.6 42.8 K.QSPINVPQYQVLDGK.G; R.IVDVLEMRPNDAADR.V
R.VTAVPTQFHFHSTSEHLLAGK.I; K.IYPLELHIVHQVTEK.L; R.EGTFSNLPAGTTIK.L
K.LGELLPSDR.D; R.ISFGQWNR.Y
K.ATVSGDHWDHGLNGENWEGK.D
R.DYVTYEGSLTTPPCSEGLLWHVMTQPQR.I
CIYKFGTSPDSKATVSGDHWDHGLNGENWEGKD GAGNAWVCKTGRKQSPINVPQYQVLDGKG SKIANGLQTQWSYPDLMSNGTSVQVINNGHTIQVQWTYNYAGHATIAIPAMHNQTNRIVDVLEMRPNDAADRVTAVPTQFHFHSTSEHLLAGKIYPLELHIVHQVTEKL EACKGGCFSVTGILFQLDNGPDNELLEPIFANMPSREGTFSNLPAGTTIKLGELLPSDRDYVTYEGSLTTPPCSEGLLWHVMTQPQRISFGQWNRY RLAVGLKECNSTETAADAGHHHHHRRLLHNHAHLEEVPAATSEPKHYFRRVMLAESANPDAYTCKAVAFGQNFRNPQYANGRTIKLARYH
3 Ferredoxin--NADP reductase 39.2 8.4 K.VLLLPADANAPLICVATGTGIAPFR.S AATKASTAVTTDMSKRTVPTKLEEGEMPLNTYSNKAPFKAKVRSVEKITGPKATGETCHIIIETEGKIPFWEGQSYGVIPPGTKINSKGKEVPTARLYSIASSRYGDDGDGQTASLCVRRAVYVDPETGKEDPAKKGLCSNFLCDATPGTEISMTGPTGKVLLLPADANAPLICVATGTGIAPFR SFWRRCFIENVPSYKFTGLFWLFMGVGNSDAKLYDEELQAIAKAYPGQFRLDYALSREQNNRKGGKMYIQDKVEEYADEIFDLLDNGAHMYFCGLKGMMPGIQDMLERVAKEKGLNYEEWVEGLKHKNQWHVEVY
4 Superoxide dismutase 23.9 10.1 R.RPEYIAAWWNVVNWEQVAENYK.A MAQALPPLPYDYGSLEPHVDATTMNIHHTKHHQTYVNNLNAALDKFPELKDLGLVDLNKAVGTDKLPKDVATVIRNNGGGHYNHSFFWKVMTNPSNTNGPNGDVKAAIEASFGSVDEMKAKFNAAAAGRFGSGWAWLSVKPDGSLSIDSTPNQDNPLMTALPDVAGGIPLLGLDVWEHAYYLKYQNRRPEYIAAWWNVVNWEQVAENYKA AQAGTVPL
5 Sedoheptulose-1,7-bisphosphatase 41.7 21.8 R.ATFDNPAYER.L
K.AVSALDIPILVCDQR.T
R.TQICYGSIGEVR.R
R.EQVAAGMGIYGPR.T
R.LINFYLGEK.Y
R.ILFEVAPLALLIEK.A
RAARVQSRRTAVLTQAKIGDSLAEFLVEATPDPKLRHVMMSMAEATRTIAHKVRTASCAGTACVNSFGDEQLAVDMVADKLLFEALKYSHVCKLACSEEVPEPVDMGGEGFCVAFDPLDGSSSSDTNFAVGTIFGVWPGDKLTNITGREQVAAGMGIYGPRT VFCIALKDAPGCHEFLLMDDGKWMHVKETTHIGEGKMFAPGNLRATFDNPAYERLINFYLGEKY TLRYTGGIVPDLFQIIVKEKGVFTNLTSPTTKAKLRILFEVAPLALLIEKA GGASSCDGKAVSALDIPILVCDQRTQICYGSIGEVR RFEEYMYGTSPRFSEKVVA
6 ATP synthase subunit alpha 54.7 53.5 K.MVDFGIVFQVGDGIAR.I; K.IAEIPVGEAYLGR.V
R.VVDGLARPVDGK.G; R.AIESPAPGIVAR.R
R.SVYEPLATGLVAVDAMIPVGR.G
K.TAIAVDTILNQK.G; K.ASSVAQVLNTLKER.G
R.EAYPGDVFYLHSR.L
K.LKLELAQFAELEAFSQFASDLDQATQNQLAR.G
R.STLTFTPEAEGLVK.Q; K.QAINEYLEEFKSQAK.A
R.TPEELSNLIKDLIEQYTPEVK.M; K.QAQAYREMSLLLR.R; K.DLIEQYTPEVK.M; K.GVICVYVAIGQK.A; K.QPQSSPLSVEEQVASLYAGTNGYLDKLEVSQVR.A
MAMRTPEELSNLIKDLIEQYTPEVKMVDFGIVFQVGDGIARI YGLEKAMSGELLEFEDGTLGIALNLEANNVGAVLLGDGLKITEGSRVRCTGKIAEIPVGEAYLGRVVDGLARPVDGKG AVQTKDSRAIESPAPGIVARRSVYEPLATGLVAVDAMIPVGRG QRELIIGDRQTGKTAIAVDTILNQKGKGVICVYVAIGQKASSVAQVLNTLKERG ALDYTIIVMANANEPATLQYLAPYTGATLAEYFMYTGRPTLTIYDDLSKQAQAYREMSLLLR RPPGREAYPGDVFYLHSRL LERAAKLNNALGEGSMTALPIVETQEGDVSAYIPTNVISITDGQIFLAAGLFNSGLRPAINVGISVSRVGSAAQPKAMKQVAGKLKLELAQFAELEAFSQFASDLDQATQNQLARG ARLREILKQPQSSPLSVEEQVASLYAGTNGYLDKLEVSQVRA YLSGLRSYLANSYPKYGEILRSTLTFTPEAEGLVKQAINEYLEEFKSQAKA A
7 ATP synthase subunit beta 52.0 30.9 K.GQVPNIYNALTIR.A; R.TAPAFVDLDTRLSIFETGIK.V
R.LSIFETGIK.V; K.VVDLLAPYR.R
K.VVDLLAPYRR.G; K.IGLFGGAGVGK.T
K.AHGGVSVFAGVGER.T; K.VALVYGQMNEPPGAR.M
R.DVNKQDVLFFIDNIFR.F; R.FVQAGAEVSALLGR.M
R.TAPAFVDLDTR.L; R.VALTALTMAEYFR.D
R.DVNKQDVLFFIDNIFR.F; K.TVLIMELINNIAK.A
K.QDVLFFIDNIFR.F
MSDSIETKNMGRIVQIIGPVLDIVFAKGQVPNIYNALTIRA KNSAGTEMAVTCEVQQLLGDNCVRAVSMNPTEGLMRGMEVVDTGKPLSVPVGKVTLGRIFNVLGEPVDNMGNVKVEETLPIHRTAPAFVDLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERT REGNDLYTEMKESGVIVEKNLSDSKVALVYGQMNEPPGARMRVALTALTMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRM PSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLESTSTMLQPWILGEKHYDSAQSVKKTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFGKIFAGELDDLPEQAFYLVGNITEAISKAASLK
8 ATP synthase gamma chain 38.7 15.0 K.VLYGVNQR.V; R.SLQEALASELAAR.M
R.AQEAVVNGRPFSENLVK.V
K.SVLLVVLTGDR.
MAAMLASKQGAFMGRSSFAPAPKGVASRGSLQVVAGLKEVRDRIASVKNTQKITDAMKLVAAAKVRRAQEAVVNGRPFSENLVKVLYGVNQRV RQEDVDSPLCAVRPVKSVLLVVLTGDR GLCGGYNNFIIKKTEARYRELTAMGVKVNLVCVGRKGAQYFARRKQYNIVKSFSLGAAPSTKEAQGIADEIFASFIAQESDKVELVFTKFISLINSNPTIQTLLPMTPMGELCDVDGKCVDAADDEIFKLTTKGGEFAVEREKTTIETEALDPSLIFEQEPAQILDALLPLYMSSCLLRSLQEALASELAARM NAMNNASDNAKELKKGLTVQYNKQRQAKITQELAEIVGGAAATSG
9 Oxygen evolving enhancer protein (OEE)1 30.5 20.8 R.VAFLFTIK.Q
K.VTGLWYAQLK
K.VGSDGSAELKEDDGIDYAATTVQLPGGER.V
LTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQ FDGKGTLDGIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPARADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK
10 OEE2 25.8 25.5 K.WNPSKENDFPGVILR.Y; K.ENDFPGVILR.Y
K.QAYSGETQSEGGFAPNR.V; K.TYYKYELLVR.S
AYGDSANVFGKVTNKSGFVPYAGDGFALLLPAKWNPSKENDFPGVILRY EDNFDAVNNLVVIAQDTDKKAIADFGSQDKFLESVSYLLGKQAYSGETQSEGGFAPNRV SAASLLDVSTTTDKKGKTYYKYELLVRS ADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKKEAMGAFDSFTVV
11 OEE-3 21.8 25.6 K.EFIQAVEDLDFALR.E; R.DRGFDLIYEAR.D
R.GFDLIYEAR.D; R.DLDLPQNVR.E
LTPVDLFDDRSVRDRGFDLIYEARDLDLPQNVRE GFTQARASLDETKKRVKESEARIDADLDVFIQKSYWTEAREQLRRQVGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVEDLDFALRE KDQASAAKKLEITKAKLDSVLAAVL
12 Ribulose bisphosphate carboxylase
(RuBisCO) (LC)
52.5 2.5 R.FLFVAEAIYK.A TKAGAGFKAGVKDYRLTYYTPDYVVRDTDILAAFRMTPQLGVPPEECGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEDNQYIAYVAYPIDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFVGPPHGIQVERDKLNKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVAEAIYKA QAETGEVKGHYLNATAGTCEEMMKRAVCAKELGVPIIMHDYLTGGFTANTSLAIYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRMSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDDYVEKDRSRGIYFTQDWCSMPGVMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLAREGGDVIRSACKWSPELAAACEVWKEIKFEFDTIDKL
13 RuBisCO (SC) 20.6 39.3 K.AYVSNESAIR.F; R.FGSVSCLYYDNR.Y
K.AFPDAYVR.L; K.QVQIMGFLVQRPK.T
R.DFQPANKR.S
MMVWTPVNNKMFETFSYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESAIRFGSVSCLYYDNR YWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVR LVAFDNQKQVQIMGFLVQRPK TARDFQPANKR SV